PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr2g059540.1
Common NameMTR_2g059540
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family Dof
Protein Properties Length: 207aa    MW: 23289.6 Da    PI: 8.1788
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr2g059540.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.46.4e-383087562
           zf-Dof  5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                     alkcprC+s ntkfCyynny+lsqPr+fCk+CrryWtkGG lrnvPvGgg++k+kks+
  Medtr2g059540.1 30 ALKCPRCNSFNTKFCYYNNYNLSQPRHFCKNCRRYWTKGGILRNVPVGGGSQKSKKSK 87
                     689***************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027017.1E-333185IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.8453185IPR003851Zinc finger, Dof-type
ProDomPD0074783.0E-243181IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103369IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 207 aa     Download sequence    Send to blast
MADGNLFCIE EDRRMKTYHN QNNHHHHHLA LKCPRCNSFN TKFCYYNNYN LSQPRHFCKN  60
CRRYWTKGGI LRNVPVGGGS QKSKKSKTAS SSSIPSSAAT TPTPLQPEAD KSDSHSNSDG  120
STIRVNSVIE NEQVNSFRNL IISSSTNDQV HVVQHGDSVM LNHQQFSNEF GSLDWEGGAN  180
TVDQSYWTQS HWSDHVIHSS SLFHLP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1364500.0AC136450.7 Medicago truncatula clone mth2-34d6, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003595715.11e-155Dof domain zinc finger protein
TrEMBLG7IGN81e-155G7IGN8_MEDTR; Dof domain zinc finger protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59983050
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.11e-32OBF binding protein 4
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]